Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pET21d-colEdes2/Imdes2 Resource Report Resource Website |
RRID:Addgene_107109 | colEdes2/Imdes2 | Synthetic | Ampicillin | PMID:30538236 | Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes2: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWKEVAKDPDLAKQFKRANRRNIKQGRAPFAPKKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes2: MELKHSISDYTEAEFLEFVKKIYNSTDEEKQKELVTEFERLTEHPSGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH | Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:06 | 0 | |
|
pGEX-6P-3-F37A+L196F+V252A+C253G-hADPRM Resource Report Resource Website |
RRID:Addgene_107163 | F37A+L196F+V252A+C253G-hADPRM GST-mutant cADPR phosphohydrolase gene | Synthetic | Ampicillin | PMID:29348648 | Backbone Marker:GE Healthcare; Backbone Size:4946; Vector Backbone:pGEX-6P-3; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:09 | 0 | ||
|
pll2.4 Resource Report Resource Website |
RRID:Addgene_107205 | PLL 2.4 | Synthetic | Kanamycin | PMID:30018322 | Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:07 | 0 | ||
|
pll2.2 Resource Report Resource Website |
RRID:Addgene_107203 | PLL 2.2 | Synthetic | Kanamycin | PMID:30018322 | Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:07 | 0 | ||
|
xyl3.1 Resource Report Resource Website |
RRID:Addgene_107209 | xyl3.1 | Synthetic | Kanamycin | PMID:30018322 | Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:07 | 0 | ||
|
pll4.1 Resource Report Resource Website |
RRID:Addgene_107208 | PLL 4.1 | Synthetic | Kanamycin | PMID:30018322 | Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:07 | 0 | ||
|
pll3.1 Resource Report Resource Website |
RRID:Addgene_107207 | PLL 3.1 | Synthetic | Kanamycin | PMID:30018322 | Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:09 | 0 | ||
|
pXPR_047 Resource Report Resource Website 10+ mentions |
RRID:Addgene_107145 | GFP + sgRNA for GFP | Synthetic | Ampicillin | gRNA sequence is GGTGAACCGCATCGAGCTGA pLKO TRC v2 library vector, Puro selection and eGFP expression. | Vector Backbone:pXPR_047; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:07 | 11 | ||
|
xyl8.2 Resource Report Resource Website |
RRID:Addgene_107216 | xyl8.2 | Synthetic | Kanamycin | PMID:30018322 | Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:08 | 0 | ||
|
ecAT3.10 Resource Report Resource Website 1+ mentions |
RRID:Addgene_107215 | ecAT3.10 | Synthetic | Ampicillin | PMID:29121644 | Backbone Marker:modified from Invitrogen; Backbone Size:5000; Vector Backbone:pCMV(MinDis) [variant of pDisplay]; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:01:09 | 2 | ||
|
xyl8.1 Resource Report Resource Website |
RRID:Addgene_107214 | xyl8.1 | Synthetic | Kanamycin | PMID:30018322 | Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:08 | 0 | ||
|
xyl4.2 Resource Report Resource Website |
RRID:Addgene_107213 | xyl4.2 | Synthetic | Kanamycin | PMID:30018322 | Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:08 | 0 | ||
|
xyl3.2 Resource Report Resource Website |
RRID:Addgene_107210 | xyl3.2 | Synthetic | Kanamycin | PMID:30018322 | Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:08 | 0 | ||
|
pUC57-PP7v3 Resource Report Resource Website |
RRID:Addgene_107230 | 24xPP7v3 | Synthetic | Kanamycin | PMID:29281824 | Vector Backbone:pUC57; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:01:09 | 0 | ||
|
MSGV1-1D3-28Z.1-3 mut Resource Report Resource Website 1+ mentions |
RRID:Addgene_107227 | 1D3-28Z. 1-3 mut | Synthetic | Ampicillin | PMID:20631379 | Backbone Size:5586; Vector Backbone:MSGV1; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | None | 2026-08-15 01:01:08 | 6 | |
|
MSGV-1D3-28Z All ITAMs intact Resource Report Resource Website 1+ mentions |
RRID:Addgene_107226 | 1D3-28Z All ITAMs intact | Synthetic | Ampicillin | PMID:20631379 | Backbone Size:5584; Vector Backbone:MSGV1; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | None | 2026-08-15 01:01:09 | 8 | |
|
pCSD_2xNLS-SpCas9WT-NLS-3xHA-NLS-dSaCas9-2xNLS Resource Report Resource Website |
RRID:Addgene_107319 | SpCas9-SaCas9 fusion | Synthetic | Ampicillin | PMID:30451839 | Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | SpCas9 is fused to nuclease dead SaCas9 (D10A, N580A) | 2026-08-15 01:01:08 | 0 | |
|
pCSD_2xNLS-SpCas9MT3-NLS-3xHA-NLS-dSaCas9-2xNLS Resource Report Resource Website |
RRID:Addgene_107318 | SpCas9-SaCas9 fusion | Synthetic | Ampicillin | PMID:30451839 | Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | SpCas9 (R1335K) fused to nuclease dead SaCas9 (D10A, N580A) | 2026-08-15 01:01:09 | 0 | |
|
pCSD_2XNLS-SpCas9MT2-NLS-3xHA-2XNLS-NmCas9WT-2XNLS Resource Report Resource Website |
RRID:Addgene_107326 | SpCas9-NmCas9 fusion | Synthetic | Ampicillin | PMID:30451839 | Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | SpCas9 (R1333S) is fused to NmCas9 | 2026-08-15 01:01:09 | 0 | |
|
pCSD_2XNLS-SpCas9MT3-NLS-3xHA-2XNLS-NmCas9WT-2XNLS Resource Report Resource Website |
RRID:Addgene_107325 | SpCas9-NmCas9 fusion | Synthetic | Ampicillin | PMID:30451839 | Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | SpCas9 (R1335K) is fused to NmCas9 | 2026-08-15 01:01:09 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.