Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Organism:synthetic (facet)

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

30,421 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Insert Name

Sort Ascending

Sort Descending

 Organism

Sort Ascending

Sort Descending

 Bacterial Resistance

Sort Ascending

Sort Descending

 Defining Citation

Sort Ascending

Sort Descending

 Comments
Vector Backbone Description
Relevant Mutation
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
pET21d-colEdes2/Imdes2
 
Resource Report
Resource Website 		RRID:Addgene_107109 colEdes2/Imdes2 Synthetic Ampicillin PMID:30538236 Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes2: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWKEVAKDPDLAKQFKRANRRNIKQGRAPFAPKKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes2: MELKHSISDYTEAEFLEFVKKIYNSTDEEKQKELVTEFERLTEHPSGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:06 0
pGEX-6P-3-F37A+L196F+V252A+C253G-hADPRM
 
Resource Report
Resource Website 		RRID:Addgene_107163 F37A+L196F+V252A+C253G-hADPRM GST-mutant cADPR phosphohydrolase gene Synthetic Ampicillin PMID:29348648 Backbone Marker:GE Healthcare; Backbone Size:4946; Vector Backbone:pGEX-6P-3; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:09 0
pll2.4
 
Resource Report
Resource Website 		RRID:Addgene_107205 PLL 2.4 Synthetic Kanamycin PMID:30018322 Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:07 0
pll2.2
 
Resource Report
Resource Website 		RRID:Addgene_107203 PLL 2.2 Synthetic Kanamycin PMID:30018322 Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:07 0
xyl3.1
 
Resource Report
Resource Website 		RRID:Addgene_107209 xyl3.1 Synthetic Kanamycin PMID:30018322 Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:07 0
pll4.1
 
Resource Report
Resource Website 		RRID:Addgene_107208 PLL 4.1 Synthetic Kanamycin PMID:30018322 Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:07 0
pll3.1
 
Resource Report
Resource Website 		RRID:Addgene_107207 PLL 3.1 Synthetic Kanamycin PMID:30018322 Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:09 0
pXPR_047
 
Resource Report
Resource Website
10+ mentions 		RRID:Addgene_107145 GFP + sgRNA for GFP Synthetic Ampicillin gRNA sequence is GGTGAACCGCATCGAGCTGA pLKO TRC v2 library vector, Puro selection and eGFP expression. Vector Backbone:pXPR_047; Vector Types:Mammalian Expression, Lentiviral, CRISPR; Bacterial Resistance:Ampicillin 2026-08-15 01:01:07 11
xyl8.2
 
Resource Report
Resource Website 		RRID:Addgene_107216 xyl8.2 Synthetic Kanamycin PMID:30018322 Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:08 0
ecAT3.10
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_107215 ecAT3.10 Synthetic Ampicillin PMID:29121644 Backbone Marker:modified from Invitrogen; Backbone Size:5000; Vector Backbone:pCMV(MinDis) [variant of pDisplay]; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2026-08-15 01:01:09 2
xyl8.1
 
Resource Report
Resource Website 		RRID:Addgene_107214 xyl8.1 Synthetic Kanamycin PMID:30018322 Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:08 0
xyl4.2
 
Resource Report
Resource Website 		RRID:Addgene_107213 xyl4.2 Synthetic Kanamycin PMID:30018322 Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:08 0
xyl3.2
 
Resource Report
Resource Website 		RRID:Addgene_107210 xyl3.2 Synthetic Kanamycin PMID:30018322 Vector Backbone:pETMBPH; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:08 0
pUC57-PP7v3
 
Resource Report
Resource Website 		RRID:Addgene_107230 24xPP7v3 Synthetic Kanamycin PMID:29281824 Vector Backbone:pUC57; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin 2026-08-15 01:01:09 0
MSGV1-1D3-28Z.1-3 mut
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_107227 1D3-28Z. 1-3 mut Synthetic Ampicillin PMID:20631379 Backbone Size:5586; Vector Backbone:MSGV1; Vector Types:Retroviral; Bacterial Resistance:Ampicillin None 2026-08-15 01:01:08 6
MSGV-1D3-28Z All ITAMs intact
 
Resource Report
Resource Website
1+ mentions 		RRID:Addgene_107226 1D3-28Z All ITAMs intact Synthetic Ampicillin PMID:20631379 Backbone Size:5584; Vector Backbone:MSGV1; Vector Types:Retroviral; Bacterial Resistance:Ampicillin None 2026-08-15 01:01:09 8
pCSD_2xNLS-SpCas9WT-NLS-3xHA-NLS-dSaCas9-2xNLS
 
Resource Report
Resource Website 		RRID:Addgene_107319 SpCas9-SaCas9 fusion Synthetic Ampicillin PMID:30451839 Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin SpCas9 is fused to nuclease dead SaCas9 (D10A, N580A) 2026-08-15 01:01:08 0
pCSD_2xNLS-SpCas9MT3-NLS-3xHA-NLS-dSaCas9-2xNLS
 
Resource Report
Resource Website 		RRID:Addgene_107318 SpCas9-SaCas9 fusion Synthetic Ampicillin PMID:30451839 Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin SpCas9 (R1335K) fused to nuclease dead SaCas9 (D10A, N580A) 2026-08-15 01:01:09 0
pCSD_2XNLS-SpCas9MT2-NLS-3xHA-2XNLS-NmCas9WT-2XNLS
 
Resource Report
Resource Website 		RRID:Addgene_107326 SpCas9-NmCas9 fusion Synthetic Ampicillin PMID:30451839 Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin SpCas9 (R1333S) is fused to NmCas9 2026-08-15 01:01:09 0
pCSD_2XNLS-SpCas9MT3-NLS-3xHA-2XNLS-NmCas9WT-2XNLS
 
Resource Report
Resource Website 		RRID:Addgene_107325 SpCas9-NmCas9 fusion Synthetic Ampicillin PMID:30451839 Vector Backbone:pCSDest2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin SpCas9 (R1335K) is fused to NmCas9 2026-08-15 01:01:09 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch