Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search
Reset search
On page 65 showing 1281 ~ 1300 out of 1,737 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to a Collection

    • RRID:Addgene_61453

http://www.addgene.org/61453

Species: E. coli
Genetic Insert: msd(wt)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61453 Copy   

    • RRID:Addgene_61447

http://www.addgene.org/61447

Species: E. coli
Genetic Insert: msd_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61447 Copy   

    • RRID:Addgene_61448

http://www.addgene.org/61448

Species: E. coli
Genetic Insert: SCRIBE_kanR(ON)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61448 Copy   

    • RRID:Addgene_61449

http://www.addgene.org/61449

Species: E. coli
Genetic Insert: SCRIBE_galK(OFF)
Vector Backbone Description: Backbone Marker:Expressys; Vector Backbone:pZE32; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25395541

Proper citation: RRID:Addgene_61449 Copy   

    • RRID:Addgene_61971

    This resource has 1+ mentions.

http://www.addgene.org/61971

Species: E. coli
Genetic Insert: lacZ alpha
Vector Backbone Description: Vector Backbone:pEGFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_61971 Copy   

    • RRID:Addgene_62392

http://www.addgene.org/62392

Species: E. coli
Genetic Insert: MG1655-tMMR
Vector Backbone Description: Vector Backbone:genomic; Vector Types:; Bacterial Resistance:Tetracycline
Defining Citation: PMID:24500200
Comments: For detailed use and MAGE, see: 1. Nyerges, Á. et al. Conditional DNA repair mutants enable highly precise genome engineering. Nucl. Acids Res. 42, e62–e62 (2014). 2. Gallagher, R. R., Li, Z., Lewis, A. O. & Isaacs, F. J. Rapid editing and evolution of bacterial genomes using libraries of synthetic DNA. Nat. Protocols 9, 2301–2316 (2014). 3. Bonde, M. T., Anderson, M. V., Wallin, A. I. N., Wang, H. H. & Sommer, M. O. A. MODEST: a web-based design tool for oligonucleotide-mediated genome engineering and recombineering. Nucl. Acids Res. (2014). doi:10.1093/nar/gku428

Proper citation: RRID:Addgene_62392 Copy   

http://www.addgene.org/62646

Species: E. coli
Genetic Insert: OmpA
Vector Backbone Description: Backbone Marker:DNA2.0; Backbone Size:4000; Vector Backbone:pJexpress414; Vector Types:Bacterial Expression, Synthetic Biology; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26199411
Comments: AA sequence: MKKTAIAIAVALAGFATVAQAAPNDNTWYTGAKLGWSQYHDTGFI NNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLG YPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWT NNIGDYPYDVPDYATRPDNGMLSLGVSYRFGCCPGCCHHHHHH

Proper citation: RRID:Addgene_62646 Copy   

    • RRID:Addgene_72650

http://www.addgene.org/72650

Species: E. coli
Genetic Insert: mEos2-ZapA
Vector Backbone Description: Backbone Marker:NBRP-E.coli at NIG; Backbone Size:4500; Vector Backbone:pCA24N; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25848771

Proper citation: RRID:Addgene_72650 Copy   

    • RRID:Addgene_72651

http://www.addgene.org/72651

Species: E. coli
Genetic Insert: ZapB-mEos2
Vector Backbone Description: Backbone Marker:NBRP-E.coli at NIG; Backbone Size:4500; Vector Backbone:pCA24N; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:25848771

Proper citation: RRID:Addgene_72651 Copy   

    • RRID:Addgene_72653

http://www.addgene.org/72653

Species: E. coli
Genetic Insert: MatP-mEos2
Vector Backbone Description: Backbone Marker:P. de Boer (Hale et al. EMBO J 2001); Backbone Size:7839; Vector Backbone:pDR122; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:25848771

Proper citation: RRID:Addgene_72653 Copy   

http://www.addgene.org/73188

Species: E. coli
Genetic Insert: folA dihydrofolate reductase
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5708; Vector Backbone:pET15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_73188 Copy   

    • RRID:Addgene_65606

http://www.addgene.org/65606

Species: E. coli
Genetic Insert: FadD
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5420; Vector Backbone:pETDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26157619

Proper citation: RRID:Addgene_65606 Copy   

    • RRID:Addgene_65605

http://www.addgene.org/65605

Species: E. coli
Genetic Insert: FadD
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5420; Vector Backbone:pETDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26157619

Proper citation: RRID:Addgene_65605 Copy   

    • RRID:Addgene_65607

http://www.addgene.org/65607

Species: E. coli
Genetic Insert: FadD
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5420; Vector Backbone:pETDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26157619

Proper citation: RRID:Addgene_65607 Copy   

    • RRID:Addgene_65602

http://www.addgene.org/65602

Species: E. coli
Genetic Insert: FadD
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5420; Vector Backbone:pETDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26157619

Proper citation: RRID:Addgene_65602 Copy   

    • RRID:Addgene_65609

http://www.addgene.org/65609

Species: E. coli
Genetic Insert: FadD
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5420; Vector Backbone:pETDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26157619

Proper citation: RRID:Addgene_65609 Copy   

    • RRID:Addgene_65567

http://www.addgene.org/65567

Species: E. coli
Genetic Insert: FadD with Q338R mutation
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5420; Vector Backbone:pETDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26157619

Proper citation: RRID:Addgene_65567 Copy   

    • RRID:Addgene_65570

http://www.addgene.org/65570

Species: E. coli
Genetic Insert: FadD with V4F, W5L mutations
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5420; Vector Backbone:pETDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26157619

Proper citation: RRID:Addgene_65570 Copy   

    • RRID:Addgene_65575

http://www.addgene.org/65575

Species: E. coli
Genetic Insert: FadD
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5420; Vector Backbone:pETDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26157619

Proper citation: RRID:Addgene_65575 Copy   

http://www.addgene.org/65578

Species: E. coli
Genetic Insert: FadD
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5420; Vector Backbone:pETDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26157619

Proper citation: RRID:Addgene_65578 Copy   

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X

  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Resource Identification Portal Community.

Please see Force11 for more detailed information

We thank the NIH for their support of the RRID portal Award# R24GM144308, U24DK097771, U24DA039832, HHSN276201700124P, 75N97021P00135

Recent News Entries

Contact Us

Our Information

rii-help *at* scicrunch.org

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch