Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 7 showing 121 ~ 140 out of 2,175 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection

http://www.addgene.org/165432

Species: Rattus norvegicus
Genetic Insert: tdTomato-P2A-paCaMKII(T286A)
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495

Proper citation: RRID:Addgene_165432 Copy   


http://www.addgene.org/165430

Species: Rattus norvegicus
Genetic Insert: FHS-paCaMKII(SD)
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495

Proper citation: RRID:Addgene_165430 Copy   


http://www.addgene.org/165433

Species: Rattus norvegicus
Genetic Insert: tdTomato-P2A-paCaMKII(K42M)
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495

Proper citation: RRID:Addgene_165433 Copy   


  • RRID:Addgene_165438

    This resource has 1+ mentions.

http://www.addgene.org/165438

Species: Rattus norvegicus
Genetic Insert: mEGFP(A206K)-paCaMKII
Vector Backbone Description: Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33531495
Comments: Only tested in HeLa cells, but not in neurons.

Proper citation: RRID:Addgene_165438 Copy   


http://www.addgene.org/165498

Species: Rattus norvegicus
Genetic Insert: iGluSnFR extracellular domain fused to TARP gamma-8 via NETO2 TM domain
Vector Backbone Description: Backbone Size:3950; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36622100
Comments: Chimera of iGluSnFR (Addgene plasmid # 41732), Neto2 and Gamma-8 pAAV backbone is based on Addgene plasmid # 61463 Please visit https://doi.org/10.1101/2021.01.21.427382 for bioRxiv preprint.

Proper citation: RRID:Addgene_165498 Copy   


http://www.addgene.org/166764

Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "KITTVESNSSWWTNWVIPAISALVVALMYRLYMAED" amino acid targeting sequence, which we refer to as "Cb5", for endoplasmic reticulum targeting. "7aa" indicates the 7 amino acid flexible linker region between Venus and the Cb5 targeting signal.

Proper citation: RRID:Addgene_166764 Copy   


  • RRID:Addgene_166896

http://www.addgene.org/166896

Species: Rattus norvegicus
Genetic Insert: p58
Vector Backbone Description: Vector Backbone:Halo; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33852913
Comments: Depositor confirms mutations in p58 (L405Q, R419S) do not affect plasmid function.

Proper citation: RRID:Addgene_166896 Copy   


  • RRID:Addgene_166942

    This resource has 1+ mentions.

http://www.addgene.org/166942

Species: Rattus norvegicus
Genetic Insert: p58
Vector Backbone Description: Vector Backbone:GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:11706049
Comments: Please note there are two mutations in p58-L405Q, R419S Depositor confirms these do not affect plasmid function.

Proper citation: RRID:Addgene_166942 Copy   


  • RRID:Addgene_17381

    This resource has 1+ mentions.

http://www.addgene.org/17381

Species: Rattus norvegicus
Genetic Insert: ZAP
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5100; Vector Backbone:pCDNA4 TO2 myc HisB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12215647
Comments: The NZAP fragment was excised from pBabe-NZAP-Zeo with EcoRI-NotI and cloned into pCDNA4/TO2-myc-HisB to generate a myc-tagged NZAP. The C-terminal portion of ZAP was cloned from a Rat2 cell cDNA library by PCR using sense primer CZAP-SP (5’-GAGCTCTCTGGGCTTAACC-3’) and antisense primer CZAP-AP (5’- ATATAGGCGGCCGCCCTCTGGACCTCTTCTCTTC-3’). The sense primer lies upstream from an internal NheI site in NZAP; the antisense primer introduces a NotI site immediately downstream from the coding sequence to facilitate its cloning into the myc-tagged expression vector.

Proper citation: RRID:Addgene_17381 Copy   


  • RRID:Addgene_17382

http://www.addgene.org/17382

Species: Rattus norvegicus
Genetic Insert: NZAP
Vector Backbone Description: Backbone Marker:Goff Lab; Backbone Size:0; Vector Backbone:pBabe-HAZ (modified pBabe vector); Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12215647

Proper citation: RRID:Addgene_17382 Copy   


  • RRID:Addgene_16379

    This resource has 1+ mentions.

http://www.addgene.org/16379

Species: Rattus norvegicus
Genetic Insert: PKC beta 1
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pHACE; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12794082
Comments: From user-provided sequence (see 'Reviews'), there are five amino acid differences from one of two NCBI reference sequences (AAA41868.1 and NP_001165776.1): 25A, 62F, 64K, 69C, and 294G. These "mutations" are also present in human, bovine, and xenopus sequences. An additional C-terminal mutation, H579Y, is present. These mutations are not believed to affect function.

Proper citation: RRID:Addgene_16379 Copy   


  • RRID:Addgene_16378

    This resource has 1+ mentions.

http://www.addgene.org/16378

Species: Rattus norvegicus
Genetic Insert: PKC beta 1
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pHACE; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12794082
Comments: From user-provided sequence (see 'Reviews'), there are five amino acid differences from one of two NCBI reference sequences (AAA41868.1 and NP_001165776.1): 25A, 62F, 64K, 69C, and 294G. These "mutations" are also present in human, bovine, and xenopus sequences and are therefore not believed to affect function.

Proper citation: RRID:Addgene_16378 Copy   


  • RRID:Addgene_16380

    This resource has 1+ mentions.

http://www.addgene.org/16380

Species: Rattus norvegicus
Genetic Insert: PKC beta 1
Vector Backbone Description: Backbone Size:5400; Vector Backbone:pHACE; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12794082

Proper citation: RRID:Addgene_16380 Copy   


  • RRID:Addgene_164215

http://www.addgene.org/164215

Species: Rattus norvegicus
Genetic Insert: LAMP1
Vector Backbone Description: Vector Backbone:N/A; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31539493

Proper citation: RRID:Addgene_164215 Copy   


http://www.addgene.org/164216

Species: Rattus norvegicus
Genetic Insert: LAMP1
Vector Backbone Description: Vector Backbone:N/A; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31539493

Proper citation: RRID:Addgene_164216 Copy   


http://www.addgene.org/164497

Species: Rattus norvegicus
Genetic Insert: rat Δ188Annexin A11
Vector Backbone Description: Backbone Marker:Gunter Stier; Vector Backbone:pET; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32344647

Proper citation: RRID:Addgene_164497 Copy   


http://www.addgene.org/164498

Species: Rattus norvegicus
Genetic Insert: rat Δ192Annexin A11
Vector Backbone Description: Backbone Marker:Gunter Stier; Vector Backbone:pET; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:32344647

Proper citation: RRID:Addgene_164498 Copy   


  • RRID:Addgene_180249

http://www.addgene.org/180249

Species: Rattus norvegicus
Genetic Insert: VAMP2
Vector Backbone Description: Vector Backbone:pBa-eGFP-SBP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34731031

Proper citation: RRID:Addgene_180249 Copy   


  • RRID:Addgene_1816

    This resource has 10+ mentions.

http://www.addgene.org/1816

Species: Rattus norvegicus
Genetic Insert: lysosome associated membrane protein 1
Vector Backbone Description: Backbone Marker:BD Biosciences / Clontech; Backbone Size:4700; Vector Backbone:pEYFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:14617360
Comments: Lamp-1 sequence contains a D50E mutation, which is not important for function of plasmid. There is also a silent mutation at bp#715 compared to GenBank NM_012857.1

Proper citation: RRID:Addgene_1816 Copy   


  • RRID:Addgene_1817

    This resource has 50+ mentions.

http://www.addgene.org/1817

Species: Rattus norvegicus
Genetic Insert: lysosome associated membrane protein 1
Vector Backbone Description: Backbone Size:4700; Vector Backbone:Modified Clontech Plasmid; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:14617360
Comments: Lamp-1 sequence contains a D50E mutation, which is not important for function of plasmid. There is also a silent mutation at bp#715 compared to GenBank NM_012857.1

Proper citation: RRID:Addgene_1817 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X