Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
CMV-tdTomato-P2A-paCaMKII(T286A) Resource Report Resource Website |
RRID:Addgene_165432 | tdTomato-P2A-paCaMKII(T286A) | Rattus norvegicus | Ampicillin | PMID:33531495 | Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | T286A: Autophosphorylation deficient mutation | 2026-08-15 01:09:29 | 0 | |
|
pAAV-CaMP0.4-FHS-paCaMKII(SD)-WPRE3 Resource Report Resource Website 1+ mentions |
RRID:Addgene_165430 | FHS-paCaMKII(SD) | Rattus norvegicus | Ampicillin | PMID:33531495 | Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV; Bacterial Resistance:Ampicillin | C450A, L514K, G528A, L531E, N538E: Light-insensitive mutations | 2026-08-15 01:09:28 | 1 | |
|
CMV-tdTomato-P2A-paCaMKII(K42M) Resource Report Resource Website 1+ mentions |
RRID:Addgene_165433 | tdTomato-P2A-paCaMKII(K42M) | Rattus norvegicus | Ampicillin | PMID:33531495 | Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | K42M: Kinase dead mutation | 2026-08-15 01:09:28 | 1 | |
|
CMV-mEGFP(A206K)-paCaMKII Resource Report Resource Website 1+ mentions |
RRID:Addgene_165438 | mEGFP(A206K)-paCaMKII | Rattus norvegicus | Ampicillin | PMID:33531495 | Only tested in HeLa cells, but not in neurons. | Vector Backbone:Customized Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:09:29 | 1 | |
|
pAAV-syn-SnFR-gamma8-minWPRE Resource Report Resource Website |
RRID:Addgene_165498 | iGluSnFR extracellular domain fused to TARP gamma-8 via NETO2 TM domain | Rattus norvegicus | Ampicillin | PMID:36622100 | Chimera of iGluSnFR (Addgene plasmid # 41732), Neto2 and Gamma-8 pAAV backbone is based on Addgene plasmid # 61463 Please visit https://doi.org/10.1101/2021.01.21.427382 for bioRxiv preprint. | Backbone Size:3950; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin | 2026-08-15 01:09:29 | 0 | |
|
Venus-7aa-Cb5-pEGFP-C1 Resource Report Resource Website |
RRID:Addgene_166764 | Cb5 tail anchor | Rattus norvegicus | Kanamycin | "KITTVESNSSWWTNWVIPAISALVVALMYRLYMAED" amino acid targeting sequence, which we refer to as "Cb5", for endoplasmic reticulum targeting. "7aa" indicates the 7 amino acid flexible linker region between Venus and the Cb5 targeting signal. | Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:38 | 0 | ||
|
Halo-p58 Resource Report Resource Website |
RRID:Addgene_166896 | p58 | Rattus norvegicus | Kanamycin | PMID:33852913 | Depositor confirms mutations in p58 (L405Q, R419S) do not affect plasmid function. | Vector Backbone:Halo; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | L405Q, R419S- please see depositor comments | 2026-08-15 01:09:39 | 0 |
|
GFP-p58 Resource Report Resource Website 1+ mentions |
RRID:Addgene_166942 | p58 | Rattus norvegicus | Kanamycin | PMID:11706049 | Please note there are two mutations in p58-L405Q, R419S Depositor confirms these do not affect plasmid function. | Vector Backbone:GFP; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2026-08-15 01:09:40 | 1 | |
|
pcDNA4-TO-Myc-rZAP Resource Report Resource Website 1+ mentions |
RRID:Addgene_17381 | ZAP | Rattus norvegicus | Ampicillin | PMID:12215647 | The NZAP fragment was excised from pBabe-NZAP-Zeo with EcoRI-NotI and cloned into pCDNA4/TO2-myc-HisB to generate a myc-tagged NZAP. The C-terminal portion of ZAP was cloned from a Rat2 cell cDNA library by PCR using sense primer CZAP-SP (5’-GAGCTCTCTGGGCTTAACC-3’) and antisense primer CZAP-AP (5’- ATATAGGCGGCCGCCCTCTGGACCTCTTCTCTTC-3’). The sense primer lies upstream from an internal NheI site in NZAP; the antisense primer introduces a NotI site immediately downstream from the coding sequence to facilitate its cloning into the myc-tagged expression vector. | Backbone Marker:Invitrogen; Backbone Size:5100; Vector Backbone:pCDNA4 TO2 myc HisB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:10:34 | 2 | |
|
pBabe-N-ZAP-Zeo Resource Report Resource Website |
RRID:Addgene_17382 | NZAP | Rattus norvegicus | Ampicillin | PMID:12215647 | Backbone Marker:Goff Lab; Backbone Size:0; Vector Backbone:pBabe-HAZ (modified pBabe vector); Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | N-terminal region of ZAP (amino acids 1-254) | 2026-08-15 01:10:35 | 0 | |
|
PKC beta I dNPS Resource Report Resource Website 1+ mentions |
RRID:Addgene_16379 | PKC beta 1 | Rattus norvegicus | Ampicillin | PMID:12794082 | From user-provided sequence (see 'Reviews'), there are five amino acid differences from one of two NCBI reference sequences (AAA41868.1 and NP_001165776.1): 25A, 62F, 64K, 69C, and 294G. These "mutations" are also present in human, bovine, and xenopus sequences. An additional C-terminal mutation, H579Y, is present. These mutations are not believed to affect function. | Backbone Size:5400; Vector Backbone:pHACE; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | N-terminal pseudosubstrate domain deletion: aa 30-671 | 2026-08-15 01:09:15 | 2 |
|
PKC beta I WT Resource Report Resource Website 1+ mentions |
RRID:Addgene_16378 | PKC beta 1 | Rattus norvegicus | Ampicillin | PMID:12794082 | From user-provided sequence (see 'Reviews'), there are five amino acid differences from one of two NCBI reference sequences (AAA41868.1 and NP_001165776.1): 25A, 62F, 64K, 69C, and 294G. These "mutations" are also present in human, bovine, and xenopus sequences and are therefore not believed to affect function. | Backbone Size:5400; Vector Backbone:pHACE; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2026-08-15 01:09:15 | 4 | |
|
PKC beta I CAT Resource Report Resource Website 1+ mentions |
RRID:Addgene_16380 | PKC beta 1 | Rattus norvegicus | Ampicillin | PMID:12794082 | Backbone Size:5400; Vector Backbone:pHACE; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | CAT: catalytic domain, aa 329-671 | 2026-08-15 01:09:15 | 1 | |
|
pLEX-PGK-LAMP1-EYFP Resource Report Resource Website |
RRID:Addgene_164215 | LAMP1 | Rattus norvegicus | Ampicillin | PMID:31539493 | Vector Backbone:N/A; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:09:19 | 0 | ||
|
PLEX-PGK-LAMP1-HaloTag Resource Report Resource Website |
RRID:Addgene_164216 | LAMP1 | Rattus norvegicus | Ampicillin | PMID:31539493 | Vector Backbone:N/A; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin | 2026-08-15 01:09:19 | 0 | ||
|
pETM10 with rat Δ188Annexin A11 Resource Report Resource Website |
RRID:Addgene_164497 | rat Δ188Annexin A11 | Rattus norvegicus | Kanamycin | PMID:32344647 | Backbone Marker:Gunter Stier; Vector Backbone:pET; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | N-terminal truncation | 2026-08-15 01:09:21 | 0 | |
|
pETM10 with rat Δ192Annexin A11 Resource Report Resource Website |
RRID:Addgene_164498 | rat Δ192Annexin A11 | Rattus norvegicus | Kanamycin | PMID:32344647 | Backbone Marker:Gunter Stier; Vector Backbone:pET; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | N-terminal truncation | 2026-08-15 01:09:21 | 0 | |
|
pBa.VAMP2-GFP-SBP Resource Report Resource Website |
RRID:Addgene_180249 | VAMP2 | Rattus norvegicus | Ampicillin | PMID:34731031 | Vector Backbone:pBa-eGFP-SBP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | WT | 2026-08-15 01:11:26 | 0 | |
|
Lamp1-YFP Resource Report Resource Website 10+ mentions |
RRID:Addgene_1816 | lysosome associated membrane protein 1 | Rattus norvegicus | Kanamycin | PMID:14617360 | Lamp-1 sequence contains a D50E mutation, which is not important for function of plasmid. There is also a silent mutation at bp#715 compared to GenBank NM_012857.1 | Backbone Marker:BD Biosciences / Clontech; Backbone Size:4700; Vector Backbone:pEYFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | D50E (not important for function of plasmid) | 2026-08-15 01:11:28 | 26 |
|
Lamp1-RFP Resource Report Resource Website 50+ mentions |
RRID:Addgene_1817 | lysosome associated membrane protein 1 | Rattus norvegicus | Kanamycin | PMID:14617360 | Lamp-1 sequence contains a D50E mutation, which is not important for function of plasmid. There is also a silent mutation at bp#715 compared to GenBank NM_012857.1 | Backbone Size:4700; Vector Backbone:Modified Clontech Plasmid; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | D50E (not important for function of plasmid) | 2026-08-15 01:11:28 | 98 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
