Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: Rab35 S22N
Vector Backbone Description: Backbone Marker:clontech; Backbone Size:4731; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:23264734
Proper citation: RRID:Addgene_47426 Copy
Species: Homo sapiens
Genetic Insert: MEK5-DD
Vector Backbone Description: Backbone Marker:Addgene #25752; Backbone Size:4422; Vector Backbone:pEN_TTmiRc2; Vector Types:Gateway Cloning; Bacterial Resistance:Gentamicin
Defining Citation: PMID:23332156
Proper citation: RRID:Addgene_47547 Copy
Species: Homo sapiens
Genetic Insert: Vac14
Vector Backbone Description: Backbone Marker:Agilent; Backbone Size:4324; Vector Backbone:pCMV-Tag2B; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:17161399
Proper citation: RRID:Addgene_47418 Copy
Species: Homo sapiens
Genetic Insert: Intersectin SH3 domain A
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9813051
Proper citation: RRID:Addgene_47413 Copy
Species: Homo sapiens
Genetic Insert: cyclin E1
Vector Backbone Description: Backbone Size:6521; Vector Backbone:MIGR1; Vector Types:Mammalian Expression, Retroviral, MSCV-IRES-GFP; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23873023
Comments: Human cyclin E1 (CCNE1) cDNA was mutated at N- and C-terminal Cdc4 phosphodegrons (T62A and T380A, see references) to disrupt interaction with Fbw7 ubiquitin ligase. cDNA is inserted into MIGR1 (MSCV-based retroviral vector), permitting transduction of hematopoietic cells.
Cloned cDNA contains approximately 100 bp from CCNE1 3' UTR.
GFP is co-expressed with cDNA via IRES, permitting enrichment for transduced cells using flow sorting.
References:
Koepp DM, Schaefer LK, Ye X, Keyomarsi K, Chu C, Harper JW et al (2001). Phosphorylation-dependent ubiquitination of cyclin E by the SCFFbw7 ubiquitin ligase. Science 294: 173-177.
Strohmaier H, Spruck CH, Kaiser P, Won KA, Sangfelt O, Reed SI (2001). Human F-box protein hCdc4 targets cyclin E for proteolysis and is mutated in a breast cancer cell line. Nature 413: 316-322.
Proper citation: RRID:Addgene_47498 Copy
Species: Homo sapiens
Genetic Insert: Intersectin SH3 domain D
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9813051
Proper citation: RRID:Addgene_47416 Copy
Species: Homo sapiens
Genetic Insert: ITSN1 intersectin 1
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9813051
Proper citation: RRID:Addgene_47417 Copy
Species: Homo sapiens
Genetic Insert: Intersectin SH3 domain B
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9813051
Proper citation: RRID:Addgene_47414 Copy
Species: Homo sapiens
Genetic Insert: gRNA-VEGF site 3
Vector Backbone Description: Backbone Marker:Joung lab (Addgene plasmid #43860); Backbone Size:2278; Vector Backbone:MLM3636; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23792628
Comments: Target site: GGTGAGTGAGTGTGTGCGTG
gRNA expression vector targeting human VEGF for use with JDS246 (Addgene plasmid# 43861--mammalian codon-optimized streptococcus pyogenes Cas9)
Proper citation: RRID:Addgene_47507 Copy
Species: Homo sapiens
Genetic Insert: Glucocorticoid receptor
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Proper citation: RRID:Addgene_47504 Copy
Species: Homo sapiens
Genetic Insert: beta2-adrenergic receptor
Vector Backbone Description: Backbone Size:5070; Vector Backbone:pCDNA5_FRT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23629648
Comments: Notes:
(1) The pCDNA/FRT vector contains an extra XbaI site.
(2) The XbaI restriction enzyme is sensitive to dam methylation.
Proper citation: RRID:Addgene_47438 Copy
Species: Homo sapiens
Genetic Insert: beta2-adrenergic receptor
Vector Backbone Description: Backbone Size:5070; Vector Backbone:pCDNA5_FRT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23629648
Comments: Notes:
(1) The pCDNA/FRT vector contains an extra XbaI site.
(2) The XbaI restriction enzyme is sensitive to dam methylation.
(3) No-pep sensor contains a short repeating GSG sequence at the C-terminus of mCerulean.
Proper citation: RRID:Addgene_47439 Copy
Species: Homo sapiens
Genetic Insert: beta2-adrenergic receptor
Vector Backbone Description: Backbone Size:5070; Vector Backbone:pCDNA5_FRT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23629648
Comments: Notes:
(1) The pCDNA/FRT vector contains an extra XbaI site.
(2) The XbaI restriction enzyme is sensitive to dam methylation.
Proper citation: RRID:Addgene_47437 Copy
Species: Homo sapiens
Genetic Insert: Intersectin short
Vector Backbone Description: Backbone Size:4754; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11584276
Proper citation: RRID:Addgene_47392 Copy
Species: Homo sapiens
Genetic Insert: Clavesin1
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:4324; Vector Backbone:pCMV-Tag2B; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:19651769
Proper citation: RRID:Addgene_47430 Copy
Species: Homo sapiens
Genetic Insert: intersectin long
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:11584276
Proper citation: RRID:Addgene_47395 Copy
Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid.
Lacritin protein sequence in this plasmid is: AAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
Proper citation: RRID:Addgene_48718 Copy
Species: Homo sapiens
Genetic Insert: YWHAZ
Vector Backbone Description: Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12757707
Proper citation: RRID:Addgene_48798 Copy
Species: Homo sapiens
Genetic Insert: YWHAE 14-3-3 ϵ
Vector Backbone Description: Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12757707
Proper citation: RRID:Addgene_48797 Copy
Species: Homo sapiens
Genetic Insert: AQP9
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4731; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:17346701
Proper citation: RRID:Addgene_48808 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.