Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 81 showing 1601 ~ 1620 out of 69,553 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_47426

    This resource has 1+ mentions.

http://www.addgene.org/47426

Species: Homo sapiens
Genetic Insert: Rab35 S22N
Vector Backbone Description: Backbone Marker:clontech; Backbone Size:4731; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:23264734

Proper citation: RRID:Addgene_47426 Copy   


  • RRID:Addgene_47547

    This resource has 1+ mentions.

http://www.addgene.org/47547

Species: Homo sapiens
Genetic Insert: MEK5-DD
Vector Backbone Description: Backbone Marker:Addgene #25752; Backbone Size:4422; Vector Backbone:pEN_TTmiRc2; Vector Types:Gateway Cloning; Bacterial Resistance:Gentamicin
Defining Citation: PMID:23332156

Proper citation: RRID:Addgene_47547 Copy   


  • RRID:Addgene_47418

    This resource has 1+ mentions.

http://www.addgene.org/47418

Species: Homo sapiens
Genetic Insert: Vac14
Vector Backbone Description: Backbone Marker:Agilent; Backbone Size:4324; Vector Backbone:pCMV-Tag2B; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:17161399

Proper citation: RRID:Addgene_47418 Copy   


http://www.addgene.org/47413

Species: Homo sapiens
Genetic Insert: Intersectin SH3 domain A
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9813051

Proper citation: RRID:Addgene_47413 Copy   


  • RRID:Addgene_47498

    This resource has 1+ mentions.

http://www.addgene.org/47498

Species: Homo sapiens
Genetic Insert: cyclin E1
Vector Backbone Description: Backbone Size:6521; Vector Backbone:MIGR1; Vector Types:Mammalian Expression, Retroviral, MSCV-IRES-GFP; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23873023
Comments: Human cyclin E1 (CCNE1) cDNA was mutated at N- and C-terminal Cdc4 phosphodegrons (T62A and T380A, see references) to disrupt interaction with Fbw7 ubiquitin ligase. cDNA is inserted into MIGR1 (MSCV-based retroviral vector), permitting transduction of hematopoietic cells. Cloned cDNA contains approximately 100 bp from CCNE1 3' UTR. GFP is co-expressed with cDNA via IRES, permitting enrichment for transduced cells using flow sorting. References: Koepp DM, Schaefer LK, Ye X, Keyomarsi K, Chu C, Harper JW et al (2001). Phosphorylation-dependent ubiquitination of cyclin E by the SCFFbw7 ubiquitin ligase. Science 294: 173-177. Strohmaier H, Spruck CH, Kaiser P, Won KA, Sangfelt O, Reed SI (2001). Human F-box protein hCdc4 targets cyclin E for proteolysis and is mutated in a breast cancer cell line. Nature 413: 316-322.

Proper citation: RRID:Addgene_47498 Copy   


http://www.addgene.org/47416

Species: Homo sapiens
Genetic Insert: Intersectin SH3 domain D
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9813051

Proper citation: RRID:Addgene_47416 Copy   


http://www.addgene.org/47417

Species: Homo sapiens
Genetic Insert: ITSN1 intersectin 1
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9813051

Proper citation: RRID:Addgene_47417 Copy   


http://www.addgene.org/47414

Species: Homo sapiens
Genetic Insert: Intersectin SH3 domain B
Vector Backbone Description: Backbone Size:5000; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:9813051

Proper citation: RRID:Addgene_47414 Copy   


  • RRID:Addgene_47507

    This resource has 1+ mentions.

http://www.addgene.org/47507

Species: Homo sapiens
Genetic Insert: gRNA-VEGF site 3
Vector Backbone Description: Backbone Marker:Joung lab (Addgene plasmid #43860); Backbone Size:2278; Vector Backbone:MLM3636; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23792628
Comments: Target site: GGTGAGTGAGTGTGTGCGTG gRNA expression vector targeting human VEGF for use with JDS246 (Addgene plasmid# 43861--mammalian codon-optimized streptococcus pyogenes Cas9)

Proper citation: RRID:Addgene_47507 Copy   


  • RRID:Addgene_47504

    This resource has 10+ mentions.

http://www.addgene.org/47504

Species: Homo sapiens
Genetic Insert: Glucocorticoid receptor
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin

Proper citation: RRID:Addgene_47504 Copy   


  • RRID:Addgene_47438

    This resource has 1+ mentions.

http://www.addgene.org/47438

Species: Homo sapiens
Genetic Insert: beta2-adrenergic receptor
Vector Backbone Description: Backbone Size:5070; Vector Backbone:pCDNA5_FRT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23629648
Comments: Notes: (1) The pCDNA/FRT vector contains an extra XbaI site. (2) The XbaI restriction enzyme is sensitive to dam methylation.

Proper citation: RRID:Addgene_47438 Copy   


  • RRID:Addgene_47439

http://www.addgene.org/47439

Species: Homo sapiens
Genetic Insert: beta2-adrenergic receptor
Vector Backbone Description: Backbone Size:5070; Vector Backbone:pCDNA5_FRT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23629648
Comments: Notes: (1) The pCDNA/FRT vector contains an extra XbaI site. (2) The XbaI restriction enzyme is sensitive to dam methylation. (3) No-pep sensor contains a short repeating GSG sequence at the C-terminus of mCerulean.

Proper citation: RRID:Addgene_47439 Copy   


  • RRID:Addgene_47437

http://www.addgene.org/47437

Species: Homo sapiens
Genetic Insert: beta2-adrenergic receptor
Vector Backbone Description: Backbone Size:5070; Vector Backbone:pCDNA5_FRT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23629648
Comments: Notes: (1) The pCDNA/FRT vector contains an extra XbaI site. (2) The XbaI restriction enzyme is sensitive to dam methylation.

Proper citation: RRID:Addgene_47437 Copy   


http://www.addgene.org/47392

Species: Homo sapiens
Genetic Insert: Intersectin short
Vector Backbone Description: Backbone Size:4754; Vector Backbone:pRK5; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:11584276

Proper citation: RRID:Addgene_47392 Copy   


http://www.addgene.org/47430

Species: Homo sapiens
Genetic Insert: Clavesin1
Vector Backbone Description: Backbone Marker:Stratagene; Backbone Size:4324; Vector Backbone:pCMV-Tag2B; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:19651769

Proper citation: RRID:Addgene_47430 Copy   


  • RRID:Addgene_47395

    This resource has 1+ mentions.

http://www.addgene.org/47395

Species: Homo sapiens
Genetic Insert: intersectin long
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFP-C2; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:11584276

Proper citation: RRID:Addgene_47395 Copy   


  • RRID:Addgene_48718

http://www.addgene.org/48718

Species: Homo sapiens
Genetic Insert: Lacritin
Vector Backbone Description: Backbone Marker:New England BioLabs, INC; Backbone Size:7477; Vector Backbone:pTYB1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23640897
Comments: Please note that amino acid numbering of this plasmid is relative to amino acid #20 in GenBank reference sequence NP_150593.1. E20 in the reference sequence is considered the first amino acid of lacritin in this plasmid. Lacritin protein sequence in this plasmid is: AAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA

Proper citation: RRID:Addgene_48718 Copy   


  • RRID:Addgene_48798

    This resource has 1+ mentions.

http://www.addgene.org/48798

Species: Homo sapiens
Genetic Insert: YWHAZ
Vector Backbone Description: Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12757707

Proper citation: RRID:Addgene_48798 Copy   


  • RRID:Addgene_48797

    This resource has 1+ mentions.

http://www.addgene.org/48797

Species: Homo sapiens
Genetic Insert: YWHAE 14-3-3 ϵ
Vector Backbone Description: Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12757707

Proper citation: RRID:Addgene_48797 Copy   


  • RRID:Addgene_48808

    This resource has 1+ mentions.

http://www.addgene.org/48808

Species: Homo sapiens
Genetic Insert: AQP9
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4731; Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:17346701

Proper citation: RRID:Addgene_48808 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within RRID that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X