Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Genetic Insert: TTCG_Stop-t35S_CGCT
Vector Backbone Description: Backbone Marker:Sylvestre Marillonnet; Backbone Size:2073; Vector Backbone:pAGM9121; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:36382936
Proper citation: RRID:Addgene_192353 Copy
Genetic Insert: TTCG_Stop-tNOS_CGCT
Vector Backbone Description: Backbone Marker:Sylvestre Marillonnet; Backbone Size:2073; Vector Backbone:pAGM9121; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
Defining Citation: PMID:36382936
Proper citation: RRID:Addgene_192352 Copy
Species: Caenorhabditis elegans
Genetic Insert: acr-5
Vector Backbone Description: Vector Backbone:pPD95.62; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33378642
Proper citation: RRID:Addgene_191020 Copy
Species: Homo sapiens
Genetic Insert: PRPF4
Vector Backbone Description: Backbone Size:5740; Vector Backbone:pET15-MHL; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28935721
Comments: insert+fusion tag if applicable MHHHHHHSSGRENLYFQGMASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHE sequence of insert only (no fusion tag) MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHE
Proper citation: RRID:Addgene_137233 Copy
Vector Backbone Description: Backbone Marker:Yeast vectors for integration at the HO locus. Voth WP, Richards JD, Shaw JM, Stillman DJ. Nucleic Acids Res. 2001 Jun 15;29(12); Backbone Size:3100; Vector Backbone:derived from pHO (51662); Vector Types:Synthetic Biology, Yeast genome-integrating vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35922400
Proper citation: RRID:Addgene_190268 Copy
Vector Backbone Description: Backbone Marker:Stephen Elledge (Addgene #44012); Backbone Size:12546; Vector Backbone:pINDUCER20; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Chloramphenicol and Ampicillin
Comments: C terminal mEGFP on backbone
Proper citation: RRID:Addgene_190027 Copy
Species: P. chengduensis DY56–96
Genetic Insert: ecTadA(8e)-nxCas9 (D10A)
Vector Backbone Description: Vector Backbone:colE1; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Gentamicin
Defining Citation: PMID:35389616
Proper citation: RRID:Addgene_187932 Copy
Species: Caenorhabditis elegans
Genetic Insert: dop-6
Vector Backbone Description: Vector Backbone:pPD95.62; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33378642
Proper citation: RRID:Addgene_191073 Copy
Species: Synthetic
Genetic Insert: none
Vector Backbone Description: Vector Backbone:pDRESS; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:41416770
Proper citation: RRID:Addgene_191473 Copy
Species: Synthetic
Genetic Insert: CH-GECO2.1
Vector Backbone Description: Vector Backbone:pFR; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:41416770
Proper citation: RRID:Addgene_191470 Copy
Species: Caenorhabditis elegans
Genetic Insert: flp-12
Vector Backbone Description: Vector Backbone:pPD95.62; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33378642
Proper citation: RRID:Addgene_191074 Copy
Species: Severe acute respiratory syndrome coronavirus 2
Genetic Insert: SARS-CoV-2 5' UTR SL1 alone
Vector Backbone Description: Vector Backbone:pLV; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35149555
Proper citation: RRID:Addgene_191485 Copy
Species: Homo sapiens
Genetic Insert: man1C1
Vector Backbone Description: Vector Backbone:pTRIP; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36404925
Proper citation: RRID:Addgene_183505 Copy
Species: Synthetic
Genetic Insert: mScarlet-I
Vector Backbone Description: Vector Backbone:Unspecified; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.03.26.437257v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_185926 Copy
Species: Synthetic
Genetic Insert: mOrange2
Vector Backbone Description: Vector Backbone:Unspecified; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Comments: Please visit https://www.biorxiv.org/content/10.1101/2021.03.26.437257v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_185925 Copy
Species: Ramazzottius varieornatus
Genetic Insert: Dsup
Vector Backbone Description: Vector Backbone:pLVX-Puro; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
Comments: Please visit https://doi.org/10.1101/2020.11.10.373571 for bioRxiv preprint.
Proper citation: RRID:Addgene_180635 Copy
Species: Synthetic
Genetic Insert: nGFPMNASE
Vector Backbone Description: Backbone Size:5369; Vector Backbone:pET28a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:9473618
Proper citation: RRID:Addgene_187826 Copy
Species: Porphyromonas gingivalis
Genetic Insert: Cas13b nuclease from Porphyromonas gingivalis
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pBAD33; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:35649413
Proper citation: RRID:Addgene_184833 Copy
Species: Severe acute respiratory syndrome coronavirus 2
Genetic Insert: SARS-CoV-2 5' UTR
Vector Backbone Description: Vector Backbone:pLV; Vector Types:Lentiviral, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35149555
Proper citation: RRID:Addgene_191480 Copy
Species: Severe acute respiratory syndrome coronavirus 2
Genetic Insert: SARS-CoV-2 5' UTR ΔSL1
Vector Backbone Description: Vector Backbone:pLV; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:35149555
Proper citation: RRID:Addgene_191484 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
