Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: TurboID
Vector Backbone Description: Vector Backbone:pDONR p2r-p3; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33591275
Proper citation: RRID:Addgene_166570 Copy
Species: Synthetic
Genetic Insert: BASU
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33591275
Proper citation: RRID:Addgene_166565 Copy
Genetic Insert: mKate2-P2A-TurboID
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33591275
Proper citation: RRID:Addgene_166568 Copy
Genetic Insert: miniTurbo
Vector Backbone Description: Vector Backbone:pDONR 221; Vector Types:Gateway Cloning; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33591275
Proper citation: RRID:Addgene_166567 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 2521
Proper citation: RRID:Addgene_166561 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 9255
Proper citation: RRID:Addgene_166560 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 23476
Proper citation: RRID:Addgene_166518 Copy
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 6597
Proper citation: RRID:Addgene_166519 Copy
Species: Synthetic
Genetic Insert: ActA tail anchor (Listeria monocytogenes)
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "SGLRSRGSGLRSRAQASNSAVDARGSGLRSRAQASNSAVDARGSGLRSRAQASNSAVDAR
GSGLRSRAQASNSAVDARV" amino acid targeting sequence, which we refer to as "ActA", for the mitochondrial outer membrane. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "79aa" indicates the 79 amino acid flexible linker region between Venus and the ActA targeting signal.
Proper citation: RRID:Addgene_166763 Copy
Species: Homo sapiens
Genetic Insert: Noxa
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Venus fused to the N-terminus of human Noxa amino acid sequence: "MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT". Linked by a 30 amino acid (aa) linker.
Proper citation: RRID:Addgene_166762 Copy
Species: Homo sapiens
Genetic Insert: BimEL(Mus musculus)-(Noxa BH3)
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35442739
Comments: BH3 region removed and inserted BH3 of Noxa protein. There is a K107E mutation in the Venus sequence of this plasmid. The K107E mutation is facing outwards in the B-Barrel structure of the Venus protein. Therefore, it is unlikely that this mutation would affect the chromophore within the β-barrel. We have transfected this plasmid in BMK-DKO cells and did not observe aggregation. We also used this construct and observed Forster resonance energy transfer from mCerulean3 in the context of measuring interactions with two binding partners. Thus, this mutation does not appear to affect the Venus fluorophore.
Proper citation: RRID:Addgene_166761 Copy
Species: Homo sapiens
Genetic Insert: MAO tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS" amino acid targeting sequence, which we refer to as "MAO", for mitochondrial outer membrane targeting. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "7aa" indicates the 7 amino acid flexible linker region between Venus and the ActA targeting signal for mitochondria.
Proper citation: RRID:Addgene_166765 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "KITTVESNSSWWTNWVIPAISALVVALMYRLYMAED" amino acid targeting sequence, which we refer to as "Cb5", for endoplasmic reticulum targeting. "7aa" indicates the 7 amino acid flexible linker region between Venus and the Cb5 targeting signal.
Proper citation: RRID:Addgene_166764 Copy
Species: Homo sapiens
Genetic Insert: AMOT PPxY1 fused to NEDD4L WW3
Vector Backbone Description: Backbone Size:5597; Vector Backbone:pCA528; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34284061
Proper citation: RRID:Addgene_166705 Copy
Species: Mus musculus
Genetic Insert: BimL
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30860026
Comments: Transfection of this plasmid will express "VBimL" (Venus fused to the N-terminus of the BH3-only protein, BimL) in live cells. There is a 3 amino acid flexible linker between Venus and BimL proteins. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.
Proper citation: RRID:Addgene_166734 Copy
Species: Homo sapiens
Genetic Insert: Bik
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35442739
Comments: Transfection of this plasmid will express "VBik" (Venus fused to the N-terminus of the BH3-only protein, Bik) in live cells. There is an 8 amino acid flexible linker between Venus and Bik proteins. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.
Proper citation: RRID:Addgene_166737 Copy
Species: Mus musculus
Genetic Insert: tBid
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30860026
Comments: Transfection of this plasmid will express "VtBid" (Venus fused to the N-terminus of the BH3-only protein, truncated Bid (tBid)) in live cells. In cells, caspase 8 cleavage of Bid produces the p15 fragment, referred to as tBid. There is a 3 amino acid flexible linker between Venus and tBid proteins. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.
Proper citation: RRID:Addgene_166736 Copy
Species: Mus musculus
Genetic Insert: BimEL
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30860026
Comments: Transfection of this plasmid will express "VBimEL" (Venus fused to the N-terminus of the BH3-only protein, BimEL) in live cells. There is a 3 amino acid flexible linker between Venus and BimEL proteins. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.
Proper citation: RRID:Addgene_166735 Copy
Species: Homo sapiens
Genetic Insert: Puma
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35442739
Comments: Transfection of this plasmid will express "VPuma" (Venus fused to the N-terminus of the BH3-only protein, Puma) in live cells. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric. In cloning, the last amino acid of Venus protein was deleted (K239S). Result is a 1 amino acid linker between Venus and Puma proteins. The encoded BBC3 isoform 4 is also known as PUMA-alpha.
Proper citation: RRID:Addgene_166739 Copy
Species: Homo sapiens
Genetic Insert: Bad-4E
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:30860026
Comments: Transfection of this plasmid will express "VBad-4E" (Venus fused to the N-terminus of the BH3-only protein, Bad-4E) in live cells. There is a flexible, 7 amino acid linker between Venus and Bad-4E proteins. Full length Bad protein with BH3 region hydrophobic positions H1-H4 mutated to glutamic acid (E), refered to as "BH3-4E" mutation, BH3 mutations: Y110E, L114E, M117E, F122E. When compared with EYFP, Venus fluorophore contains the following mutations: F46L, F64L, M153T, V163A and S175G. This Venus protein contains an F224R mutation to make it monomeric.
Proper citation: RRID:Addgene_166740 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
