Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: Erk activity reporter
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23882122
Comments: A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49)
Proper citation: RRID:Addgene_40015 Copy
Species: Synthetic
Genetic Insert: Erk activity reporter
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23882122
Comments: A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49)
Proper citation: RRID:Addgene_40014 Copy
Species: Synthetic
Genetic Insert: Erk activity reporter
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23882122
Comments: A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49)
Proper citation: RRID:Addgene_40007 Copy
Species: Synthetic
Genetic Insert: Erk activity reporter
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23882122
Comments: A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49)
Proper citation: RRID:Addgene_40003 Copy
Species: Synthetic
Genetic Insert: Erk activity reporter
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23882122
Comments: A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49)
Proper citation: RRID:Addgene_40002 Copy
Species: Synthetic
Genetic Insert: Erk activity reporter
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23882122
Comments: A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49)
Proper citation: RRID:Addgene_40001 Copy
Species: Synthetic
Genetic Insert: Erk activity reporter
Vector Backbone Description: Backbone Marker:unknown; Backbone Size:7711; Vector Backbone:pLenti pRRL-SV40(puro)_CMV(mcs); Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23882122
Comments: A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49)
Proper citation: RRID:Addgene_40178 Copy
Species: Synthetic
Genetic Insert: Erk activity reporter
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:4900; Vector Backbone:pTriEx4; Vector Types:Mammalian Expression, Bacterial Expression, Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23882122
Comments: A genetically encoded fluorescent sensor of ERK activity. 2008. PNAS 205(49)
Proper citation: RRID:Addgene_40174 Copy
Species: Synthetic
Genetic Insert: LOV-ipaA
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET-21b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22520757
Comments: This vector encodes a photo-activable caged form of the vinculin binding ipaA peptide.
Regarding the hybridized region, the first ten residues of the ipaA VBS1 helical peptide were identified as a close match to the last ten residues of the AsLOV2 Jα helix; five of the ten positions are identical, and the hydrophobic residues on the Jα helix that make critical contacts with the AsLOV2 domain beta-sheet at residues 539, 542, and 543 are conserved in the alignment with ipaA. Additionally, residues in the ipaA sequence that make extensive contacts with vinculin are conserved in the alignment (Ile 612, Ala 615, Ala 616, and Val 619 in ipaA). Side-chain optimization simulations were used to thread the first ten residues of ipaA onto the last ten residues of the Jα helix. The 540 position on the Jα helix was converted to isoleucine.
The LOV-ipaA gene was synthesized with a six histidine N-terminal tag (Genscript, Piscataway, NJ, USA) and cloned into the pET21b vector.
Protein coding sequence of LOV-ipaA:
MHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTANNIIKAAKDVTTSLSKVLKNIN
Proper citation: RRID:Addgene_40236 Copy
Species: Synthetic
Genetic Insert: ddYFP-B
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4100; Vector Backbone:pBad-modified; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23656278
Proper citation: RRID:Addgene_40289 Copy
Species: Synthetic
Genetic Insert: ddGFP-B
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:4100; Vector Backbone:pBad-modified; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:23656278
Proper citation: RRID:Addgene_40287 Copy
Species: Synthetic
Genetic Insert: Clover GFP
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5410; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22961245
Comments: Clover is the brightest green fluorescent protein (GFP) characterized to date, with robust performance in protein fusions. Also, it is useful as a FRET donor to mRuby2 in a FRET pair that offers bright fluorescence, dynamic range, and photostability while limiting emissions overlap.
Proper citation: RRID:Addgene_40259 Copy
Species: Synthetic
Genetic Insert: VSFP-CR
Vector Backbone Description: Backbone Marker:Invitrogen/Dr. Paulmurugan Ramasamy; Backbone Size:6107; Vector Backbone:pcDNA3.1/Puro-CAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22961245
Comments: Voltage sensor domain of Ci-VSP fused to a pair of fluorescent proteins consisting of a Clover GFP and mRuby2 RFP.
Proper citation: RRID:Addgene_40257 Copy
Species: Synthetic
Genetic Insert: AKAR2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5489; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:22961245
Comments: ECFP was replaced with GFP Clover and Citrine was replaced with RFP mRuby2.
Note: there is a small sequence insertion downstream of the insert that adds restriction sites. This is not present in the full plasmids sequence, so please refer to Addgene's QC sequence with the BGH-Rev primer for additional information.
Proper citation: RRID:Addgene_40255 Copy
Species: Synthetic
Genetic Insert: SUMO
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pBACgus_SUMOstar; Vector Types:Baculovirus; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_40391 Copy
Species: Synthetic
Genetic Insert: SUMO
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pBACgus_SUMOstar; Vector Types:Baculovirus; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_40390 Copy
Species: Synthetic
Genetic Insert: GST
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pBACgus N-His; Vector Types:Baculovirus; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_40399 Copy
Species: Synthetic
Genetic Insert: SUMO
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pBACgus_SUMOstar; Vector Types:Baculovirus; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_40395 Copy
Species: Synthetic
Genetic Insert: SUMO
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pBACgus_SUMOstar; Vector Types:Baculovirus; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_40394 Copy
Species: Synthetic
Genetic Insert: SUMO
Vector Backbone Description: Backbone Marker:Novagen; Vector Backbone:pBACgus_SUMOstar; Vector Types:Baculovirus; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_40392 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.